CHCHD3 antibody (Middle Region)
-
- Target See all CHCHD3 Antibodies
- CHCHD3 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHCHD3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CHCHD3 antibody was raised against the middle region of CHCHD3
- Purification
- Affinity purified
- Immunogen
- CHCHD3 antibody was raised using the middle region of CHCHD3 corresponding to a region with amino acids LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY
- Top Product
- Discover our top product CHCHD3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHCHD3 Blocking Peptide, catalog no. 33R-5354, is also available for use as a blocking control in assays to test for specificity of this CHCHD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHCHD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHCHD3 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3))
- Alternative Name
- CHCHD3 (CHCHD3 Products)
- Synonyms
- MINOS3 antibody, PPP1R22 antibody, 0610041L09Rik antibody, 1700039J09Rik antibody, AW558177 antibody, plxna4 antibody, FLJ20420 antibody, wu:fe23h05 antibody, zgc:111837 antibody, si:rp71-18a24.1 antibody, MGC80265 antibody, MGC88973 antibody, coiled-coil-helix-coiled-coil-helix domain containing 3 antibody, coiled-coil-helix-coiled-coil-helix domain containing 3a antibody, coiled-coil-helix-coiled-coil-helix domain containing 3 L homeolog antibody, CHCHD3 antibody, Chchd3 antibody, chchd3a antibody, chchd3.L antibody, chchd3 antibody, LOC100229580 antibody
- Background
- ChChd3 is an inner mitochondrial membrane protein and is essential for maintaining crista integrity and mitochondrial function.
- Molecular Weight
- 26 kDa (MW of target protein)
-