WIPI1 antibody (Middle Region)

Catalog No. ABIN632932

Product Details anti-WIPI1 Antibody

Target: WIPI1 (WD Repeat Domain, phosphoinositide Interacting 1 (WIPI1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WIPI1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WIPI1 antibody was raised against the middle region of WIPI1

Purification: Affinity purified

Immunogen: WIPI1 antibody was raised using the middle region of WIPI1 corresponding to a region with amino acids LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WIPI1 Blocking Peptide, catalog no. 33R-5144, is also available for use as a blocking control in assays to test for specificity of this WIPI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WIPI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WIPI1

Target: WIPI1 (WD Repeat Domain, phosphoinositide Interacting 1 (WIPI1))

Alternative Name: WIPI1 (WIPI1 Products)

Synonyms: ATG18 antibody, ATG18A antibody, WIPI49 antibody, 4930533H01Rik antibody, AW411817 antibody, D11Ertd498e antibody, RGD1307754 antibody, zgc:64205 antibody, WIPI1 antibody, atg18 antibody, wipi49 antibody, MGC145296 antibody, rgs9 antibody, wipi1 antibody, zgc:152760 antibody, WD repeat domain, phosphoinositide interacting 1 antibody, WD repeat domain, phosphoinositide interacting 1 S homeolog antibody, regulator of G protein signaling 9a antibody, WIPI1 antibody, Wipi1 antibody, wipi1 antibody, wipi1.S antibody, rgs9a antibody

Background: WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Nuclear Hormone Receptor Binding, ER-Nucleus Signaling