DCK antibody (Middle Region)

Catalog No. ABIN632979

Product Details anti-DCK Antibody

Target: DCK (Deoxycytidine Kinase (DCK))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DCK antibody was raised against the middle region of DCK

Purification: Affinity purified

Immunogen: DCK antibody was raised using the middle region of DCK corresponding to a region with amino acids ATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DCK Blocking Peptide, catalog no. 33R-1569, is also available for use as a blocking control in assays to test for specificity of this DCK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCK

Target: DCK (Deoxycytidine Kinase (DCK))

Alternative Name: DCK (DCK Products)

Synonyms: dck antibody, DCK antibody, wu:fc15f06 antibody, zgc:101771 antibody, dck1 antibody, deoxycytidine kinase antibody, deoxycytidine kinase, gene 2 L homeolog antibody, deoxycytidine kinase, gene 2 antibody, Deoxycytidine kinase antibody, deoxycytidine kinase, gene 1 L homeolog antibody, DCK antibody, dck antibody, dck.2.L antibody, dck.2 antibody, Dck antibody, FPV059 antibody, FPV151 antibody, dck.1.L antibody

Background: Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity.

Molecular Weight: 30 kDa (MW of target protein)