CPEB3 antibody (Middle Region)
-
- Target See all CPEB3 Antibodies
- CPEB3 (Cytoplasmic Polyadenylation Element Binding Protein 3 (CPEB3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CPEB3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CPEB3 antibody was raised against the middle region of CPEB3
- Purification
- Affinity purified
- Immunogen
- CPEB3 antibody was raised using the middle region of CPEB3 corresponding to a region with amino acids RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG
- Top Product
- Discover our top product CPEB3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CPEB3 Blocking Peptide, catalog no. 33R-8220, is also available for use as a blocking control in assays to test for specificity of this CPEB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPEB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPEB3 (Cytoplasmic Polyadenylation Element Binding Protein 3 (CPEB3))
- Alternative Name
- CPEB3 (CPEB3 Products)
- Synonyms
- si:ch211-129m12.2 antibody, 4831444O18Rik antibody, mKIAA0940 antibody, RGD1564670 antibody, cytoplasmic polyadenylation element binding protein 3 antibody, cpeb3 antibody, CPEB3 antibody, LOAG_07772 antibody, Cpeb3 antibody
- Background
- The function of CPEB3 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 76 kDa (MW of target protein)
-