SDR9C7 antibody (Middle Region)
-
- Target See all SDR9C7 Antibodies
- SDR9C7 (Short Chain Dehydrogenase/reductase Family 9C, Member 7 (SDR9C7))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SDR9C7 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- SDR-O antibody was raised against the middle region of SDR-O
- Purification
- Affinity purified
- Immunogen
- SDR-O antibody was raised using the middle region of SDR-O corresponding to a region with amino acids SMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADS
- Top Product
- Discover our top product SDR9C7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SDR-O Blocking Peptide, catalog no. 33R-10433, is also available for use as a blocking control in assays to test for specificity of this SDR-O antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDR-O antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SDR9C7 (Short Chain Dehydrogenase/reductase Family 9C, Member 7 (SDR9C7))
- Alternative Name
- SDR-O (SDR9C7 Products)
- Synonyms
- RDHS antibody, SDR-O antibody, SDRO antibody, 1810054F20Rik antibody, Rdh20 antibody, Rdhs antibody, Sdro antibody, Sdr-o antibody, short chain dehydrogenase/reductase family 9C member 7 antibody, 4short chain dehydrogenase/reductase family 9C, member 7 antibody, short chain dehydrogenase/reductase family 9C, member 7 antibody, SDR9C7 antibody, Sdr9c7 antibody
- Background
- SDR-O displays weak conversion of all-trans-retinal to all-trans-retinol in the presence of NADH. Has apparently no steroid dehydrogenase activity.
- Molecular Weight
- 35 kDa (MW of target protein)
-