CCT6B antibody

Catalog No. ABIN633005

Product Details anti-CCT6B Antibody

Target: CCT6B (T-Complex Protein 1 Subunit zeta-2-Like (CCT6B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCT6B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CCT6 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCT6B Blocking Peptide, catalog no. 33R-9436, is also available for use as a blocking control in assays to test for specificity of this CCT6B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCT6B

Target: CCT6B (T-Complex Protein 1 Subunit zeta-2-Like (CCT6B))

Alternative Name: CCT6B (CCT6B Products)

Synonyms: CCT-zeta-2 antibody, CCTZ-2 antibody, Cctz2 antibody, TCP-1-zeta-2 antibody, TSA303 antibody, CCTzeta-2 antibody, Cctz-2 antibody, chaperonin containing TCP1 subunit 6B antibody, T-complex protein 1 subunit zeta-2-like antibody, t-complex protein 1 subunit zeta-2-like antibody, chaperonin containing Tcp1, subunit 6b (zeta) antibody, CCT6B antibody, Cct6b antibody, LOC100445522 antibody, LOC100616822 antibody

Background: CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.

Molecular Weight: 58 kDa (MW of target protein)