CCT6B antibody
-
- Target See all CCT6B Antibodies
- CCT6B (T-Complex Protein 1 Subunit zeta-2-Like (CCT6B))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CCT6B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CCT6 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL
- Top Product
- Discover our top product CCT6B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CCT6B Blocking Peptide, catalog no. 33R-9436, is also available for use as a blocking control in assays to test for specificity of this CCT6B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCT6B (T-Complex Protein 1 Subunit zeta-2-Like (CCT6B))
- Alternative Name
- CCT6B (CCT6B Products)
- Synonyms
- CCT-zeta-2 antibody, CCTZ-2 antibody, Cctz2 antibody, TCP-1-zeta-2 antibody, TSA303 antibody, CCTzeta-2 antibody, Cctz-2 antibody, chaperonin containing TCP1 subunit 6B antibody, T-complex protein 1 subunit zeta-2-like antibody, t-complex protein 1 subunit zeta-2-like antibody, chaperonin containing Tcp1, subunit 6b (zeta) antibody, CCT6B antibody, Cct6b antibody, LOC100445522 antibody, LOC100616822 antibody
- Background
- CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.
- Molecular Weight
- 58 kDa (MW of target protein)
-