GAD antibody

Catalog No. ABIN633036

Product Details anti-GAD Antibody

Target: GAD (GAD1) (Glutamate Decarboxylase 1 (Brain, 67kDa) (GAD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GAD antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GAD1 Blocking Peptide, catalog no. 33R-5764, is also available for use as a blocking control in assays to test for specificity of this GAD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GAD

Target: GAD (GAD1) (Glutamate Decarboxylase 1 (Brain, 67kDa) (GAD1))

Alternative Name: GAD1 (GAD1 Products)

Synonyms: CPSQ1 antibody, GAD antibody, SCP antibody, GAD-67 antibody, cpsq1 antibody, gad1 antibody, gad1-A antibody, gad67 antibody, GAD67 antibody, GAD1 antibody, GLUTAMATE DECARBOXYLASE antibody, GLUTAMATE DECARBOXYLASE 1 antibody, MKP11.30 antibody, MKP11_30 antibody, glutamate decarboxylase antibody, EP10 antibody, GAD25 antibody, GAD44 antibody, Gad-1 antibody, Gad67 antibody, glutamate decarboxylase 1 antibody, glutamate decarboxylase 1 L homeolog antibody, glutamate decarboxylase antibody, glutamate decarboxylase 1b antibody, GAD1 antibody, gad1.1.L antibody, GAD antibody, Gad1 antibody, gad1b antibody

Background: This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67 kDa form and a less-frequent 25 kDa form.

Molecular Weight: 67 kDa (MW of target protein)