TMPRSS4 antibody (Middle Region)
-
- Target See all TMPRSS4 Antibodies
- TMPRSS4 (Transmembrane Protease, serine 4 (TMPRSS4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMPRSS4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMPRSS4 antibody was raised against the middle region of TMPRSS4
- Purification
- Affinity purified
- Immunogen
- TMPRSS4 antibody was raised using the middle region of TMPRSS4 corresponding to a region with amino acids LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS
- Top Product
- Discover our top product TMPRSS4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMPRSS4 Blocking Peptide, catalog no. 33R-5428, is also available for use as a blocking control in assays to test for specificity of this TMPRSS4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMPRSS4 (Transmembrane Protease, serine 4 (TMPRSS4))
- Alternative Name
- TMPRSS4 (TMPRSS4 Products)
- Synonyms
- tmprss4 antibody, zgc:152909 antibody, CAPH2 antibody, MT-SP2 antibody, TMPRSS3 antibody, mCAP2 antibody, transmembrane protease, serine 4 antibody, transmembrane protease, serine 4a antibody, TMPRSS4 antibody, tmprss4a antibody, Tmprss4 antibody
- Background
- This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene.
- Molecular Weight
- 48 kDa (MW of target protein)
-