CPLX2 antibody (N-Term)

Catalog No. ABIN633073

Product Details anti-CPLX2 Antibody

Target: CPLX2 (Complexin 2 (CPLX2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPLX2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Complexin 2 antibody was raised against the N terminal of CPLX2

Purification: Affinity purified

Immunogen: Complexin 2 antibody was raised using the N terminal of CPLX2 corresponding to a region with amino acids MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Complexin 2 Blocking Peptide, catalog no. 33R-5832, is also available for use as a blocking control in assays to test for specificity of this Complexin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPLX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPLX2

Target: CPLX2 (Complexin 2 (CPLX2))

Alternative Name: Complexin 2 (CPLX2 Products)

Synonyms: 921-L antibody, CPX-2 antibody, CPX2 antibody, Hfb1 antibody, AI413745 antibody, AW492120 antibody, MGC68923 antibody, MGC79539 antibody, complexin 2 antibody, complexin 2 L homeolog antibody, complexin-2 antibody, CPLX2 antibody, Cplx2 antibody, cplx2.L antibody, cplx2 antibody, LOC750228 antibody

Background: Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.

Molecular Weight: 15 kDa (MW of target protein)

Pathways: Synaptic Vesicle Exocytosis