NUBP1 antibody
-
- Target See all NUBP1 Antibodies
- NUBP1 (Nucleotide Binding Protein 1 (NUBP1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NUBP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NUBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM
- Top Product
- Discover our top product NUBP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NUBP1 Blocking Peptide, catalog no. 33R-5911, is also available for use as a blocking control in assays to test for specificity of this NUBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUBP1 (Nucleotide Binding Protein 1 (NUBP1))
- Alternative Name
- NUBP1 (NUBP1 Products)
- Synonyms
- DDBDRAFT_0169230 antibody, DDBDRAFT_0232424 antibody, DDB_0169230 antibody, DDB_0232424 antibody, NBP antibody, NBP1 antibody, nbp antibody, nbp1 antibody, nubp1 antibody, NBP 1 antibody, im:7144207 antibody, zgc:92138 antibody, nucleotide binding protein 1 antibody, nucleotide binding protein 1 (MinD homolog, E. coli) antibody, nucleotide binding protein 1 L homeolog antibody, nucleotide binding protein 1 S homeolog antibody, Nubp1 antibody, nubp1 antibody, NUBP1 antibody, nubp1.L antibody, nubp1.S antibody
- Background
- NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins.
- Molecular Weight
- 34 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-