CCDC146 antibody (Middle Region)

Catalog No. ABIN633113

Product Details anti-CCDC146 Antibody

Target: CCDC146 (Coiled-Coil Domain Containing 146 (CCDC146))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC146 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC146 antibody was raised against the middle region of CCDC146

Purification: Affinity purified

Immunogen: CCDC146 antibody was raised using the middle region of CCDC146 corresponding to a region with amino acids KEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC146 Blocking Peptide, catalog no. 33R-4337, is also available for use as a blocking control in assays to test for specificity of this CCDC146 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC146 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC146

Target: CCDC146 (Coiled-Coil Domain Containing 146 (CCDC146))

Alternative Name: CCDC146 (CCDC146 Products)

Synonyms: coiled-coil domain containing 146 antibody, CCDC146 antibody, Ccdc146 antibody

Background: The function of CCDC146 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 113 kDa (MW of target protein)