GLCCI1 antibody (Middle Region)
-
- Target See all GLCCI1 Antibodies
- GLCCI1 (Glucocorticoid Induced Transcript 1 (GLCCI1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GLCCI1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GLCCI1 antibody was raised against the middle region of GLCCI1
- Purification
- Affinity purified
- Immunogen
- GLCCI1 antibody was raised using the middle region of GLCCI1 corresponding to a region with amino acids PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSAD
- Top Product
- Discover our top product GLCCI1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GLCCI1 Blocking Peptide, catalog no. 33R-7448, is also available for use as a blocking control in assays to test for specificity of this GLCCI1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLCCI1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLCCI1 (Glucocorticoid Induced Transcript 1 (GLCCI1))
- Alternative Name
- GLCCI1 (GLCCI1 Products)
- Synonyms
- FAM117C antibody, GCTR antibody, GIG18 antibody, TSSN1 antibody, 2310047L21Rik antibody, A130036A18Rik antibody, Fam117c antibody, Gig18 antibody, Tssn1 antibody, sb:cb902 antibody, testhymin antibody, zgc:158237 antibody, RGD1563612 antibody, glucocorticoid induced 1 antibody, glucocorticoid induced transcript 1 antibody, glucocorticoid induced 1a antibody, glucocorticoid induced 1 L homeolog antibody, GLCCI1 antibody, Glcci1 antibody, glcci1a antibody, glcci1.L antibody
- Background
- The function of GLCCI protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 58 kDa (MW of target protein)
-