RBM11 antibody (Middle Region)

Catalog No. ABIN633164

Product Details anti-RBM11 Antibody

Target: RBM11 (RNA Binding Motif Protein 11 (RBM11))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM11 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBM11 antibody was raised against the middle region of RBM11

Purification: Affinity purified

Immunogen: RBM11 antibody was raised using the middle region of RBM11 corresponding to a region with amino acids SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM11 Blocking Peptide, catalog no. 33R-8611, is also available for use as a blocking control in assays to test for specificity of this RBM11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM11

Target: RBM11 (RNA Binding Motif Protein 11 (RBM11))

Alternative Name: RBM11 (RBM11 Products)

Synonyms: A330018F01 antibody, RNA binding motif protein 11 antibody, Rbm11 antibody, RBM11 antibody

Background: The function of the protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 19 kDa (MW of target protein)