DOK6 antibody (Middle Region)
-
- Target See all DOK6 Antibodies
- DOK6 (Docking Protein 6 (DOK6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DOK6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DOK6 antibody was raised against the middle region of DOK6
- Purification
- Affinity purified
- Immunogen
- DOK6 antibody was raised using the middle region of DOK6 corresponding to a region with amino acids IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI
- Top Product
- Discover our top product DOK6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DOK6 Blocking Peptide, catalog no. 33R-4227, is also available for use as a blocking control in assays to test for specificity of this DOK6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOK6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DOK6 (Docking Protein 6 (DOK6))
- Alternative Name
- DOK6 (DOK6 Products)
- Synonyms
- DOK5L antibody, HsT3226 antibody, Dok-6 antibody, RGD1564376 antibody, docking protein 6 antibody, DOK6 antibody, Dok6 antibody
- Background
- DOK6 is a member of the DOK family of intracellular adaptors that play a role in the RET signaling cascade.
- Molecular Weight
- 38 kDa (MW of target protein)
-