Retinoic Acid Receptor alpha antibody (N-Term)
-
- Target See all Retinoic Acid Receptor alpha (RARA) Antibodies
- Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Retinoic Acid Receptor alpha antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RARA antibody was raised against the N terminal of RARA
- Purification
- Affinity purified
- Immunogen
- RARA antibody was raised using the N terminal of RARA corresponding to a region with amino acids YESVEVGGPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNG
- Top Product
- Discover our top product RARA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RARA Blocking Peptide, catalog no. 33R-10090, is also available for use as a blocking control in assays to test for specificity of this RARA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))
- Alternative Name
- RARA (RARA Products)
- Synonyms
- NR1B1 antibody, RAR antibody, Nr1b1 antibody, RARalpha1 antibody, rar-alpha antibody, etID309833.12 antibody, rara antibody, rara2a antibody, zRAR antibody, zRAR-alpha antibody, zgc:109797 antibody, nr1b1 antibody, RAR-ALPHA1 antibody, HS-RARa antibody, fj66e06 antibody, rara2b antibody, wu:fj66e06 antibody, retinoic acid receptor alpha antibody, retinoic acid receptor, alpha antibody, retinoic acid receptor, alpha a antibody, retinoic acid receptor alpha L homeolog antibody, retinoic acid receptor, alpha b antibody, RARA antibody, Rara antibody, LOC100136372 antibody, raraa antibody, rara.L antibody, rara antibody, rarab antibody
- Background
- Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor, which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1, SMRT, and histone deacetylase. When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases, and the basic transcription machinery.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, S100 Proteins
-