Snurportin 1 antibody (Middle Region)
-
- Target See all Snurportin 1 (SNUPN) Antibodies
- Snurportin 1 (SNUPN)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Snurportin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SNUPN antibody was raised against the middle region of SNUPN
- Purification
- Affinity purified
- Immunogen
- SNUPN antibody was raised using the middle region of SNUPN corresponding to a region with amino acids GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYEL
- Top Product
- Discover our top product SNUPN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SNUPN Blocking Peptide, catalog no. 33R-3628, is also available for use as a blocking control in assays to test for specificity of this SNUPN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNUPN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Snurportin 1 (SNUPN)
- Alternative Name
- SNUPN (SNUPN Products)
- Synonyms
- rnut1 antibody, zgc:77819 antibody, wu:fc41a03 antibody, SNUPN antibody, kpnbl antibody, snurportin1 antibody, KPNBL antibody, RNUT1 antibody, Snurportin1 antibody, 0610031A09Rik antibody, Rnut1 antibody, Snupn1 antibody, snurportin 1 antibody, snupn antibody, SNUPN antibody, Snupn antibody
- Background
- The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. SNUPN interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor.
- Molecular Weight
- 41 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Protein targeting to Nucleus
-