PRPF4 antibody
-
- Target See all PRPF4 Antibodies
- PRPF4 (PRP4 Pre-mRNA Processing Factor 4 Homolog (PRPF4))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRPF4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PRPF4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT
- Top Product
- Discover our top product PRPF4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRPF4 Blocking Peptide, catalog no. 33R-2784, is also available for use as a blocking control in assays to test for specificity of this PRPF4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRPF4 (PRP4 Pre-mRNA Processing Factor 4 Homolog (PRPF4))
- Alternative Name
- PRPF4 (PRPF4 Products)
- Synonyms
- zgc:65943 antibody, mg:ab03a02 antibody, GB19235 antibody, DDBDRAFT_0187564 antibody, DDBDRAFT_0233058 antibody, DDB_0187564 antibody, DDB_0233058 antibody, HPRP4 antibody, HPRP4P antibody, PRP4 antibody, Prp4p antibody, SNRNP60 antibody, 1600015H11Rik antibody, AI874830 antibody, AW047464 antibody, bN189G18.1 antibody, pre-mRNA processing factor 4 antibody, PRP4 pre-mRNA processing factor 4 homolog (yeast) antibody, pre-mRNA processing factor 4 L homeolog antibody, U4/U6 small nuclear ribonucleoprotein Prp4 antibody, U4/U6 small nuclear ribonucleoprotein antibody, Prpf4 antibody, prpf4 antibody, prpf4.L antibody, PRPF4 antibody, LOC409689 antibody
- Background
- The removal of introns from nuclear pre-mRNAs occurs on complexes called spliceosomes, which are made up of 4 small nuclear ribonucleoprotein (snRNP) particles and an undefined number of transiently associated splicing factors.
- Molecular Weight
- 58 kDa (MW of target protein)
-