CSTF2 antibody (N-Term)

Catalog No. ABIN633237

Product Details anti-CSTF2 Antibody

Target: CSTF2 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa (CSTF2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSTF2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CSTF2 antibody was raised against the N terminal of CSTF2

Purification: Affinity purified

Immunogen: CSTF2 antibody was raised using the N terminal of CSTF2 corresponding to a region with amino acids VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CSTF2 Blocking Peptide, catalog no. 33R-9471, is also available for use as a blocking control in assays to test for specificity of this CSTF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSTF2

Target: CSTF2 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa (CSTF2))

Alternative Name: CSTF2 (CSTF2 Products)

Synonyms: CSTF2 antibody, CstF-64 antibody, fb11e07 antibody, zgc:56346 antibody, zgc:77730 antibody, wu:fb11e07 antibody, 64kDa antibody, C630034J23Rik antibody, Cstf64 antibody, CSFT64 antibody, cstF-64 antibody, cstf-64 antibody, cleavage stimulation factor subunit 2 antibody, cleavage stimulation factor, 3' pre-RNA, subunit 2 antibody, cleavage stimulation factor, 3' pre-RNA subunit 2 antibody, CSTF2 antibody, cstf2 antibody, Cstf2 antibody, cstf2.L antibody

Background: CSTF2 is a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs.

Molecular Weight: 61 kDa (MW of target protein)