SNRPD2 antibody (Middle Region)
-
- Target See all SNRPD2 Antibodies
- SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SNRPD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SNRPD2 antibody was raised against the middle region of SNRPD2
- Purification
- Affinity purified
- Immunogen
- SNRPD2 antibody was raised using the middle region of SNRPD2 corresponding to a region with amino acids ENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAG
- Top Product
- Discover our top product SNRPD2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SNRPD2 Blocking Peptide, catalog no. 33R-2619, is also available for use as a blocking control in assays to test for specificity of this SNRPD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))
- Alternative Name
- SNRPD2 (SNRPD2 Products)
- Synonyms
- SMD2 antibody, SNRPD1 antibody, Sm-D2 antibody, sm-d2 antibody, smd2 antibody, snrpd1 antibody, 170.t00019 antibody, NCU03778.1 antibody, 1810009A06Rik antibody, im:6908977 antibody, si:dkey-113g17.2 antibody, zgc:110732 antibody, small nuclear ribonucleoprotein D2 polypeptide antibody, small nuclear ribonucleoprotein D2 polypeptide L homeolog antibody, small nuclear ribonucleoprotein Sm D2 antibody, small nuclear ribonucleoprotein sm D2 antibody, small nuclear ribonucleoprotein sm d2 antibody, small nuclear ribonucleoprotein D2 antibody, SNRPD2 antibody, snrpd2 antibody, snrpd2.L antibody, EHI_108640 antibody, NCU03778 antibody, PVX_002615 antibody, SMP4 antibody, EDI_187160 antibody, LOC100036587 antibody, Snrpd2 antibody
- Background
- SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.
- Molecular Weight
- 13 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-