DDX59 antibody

Catalog No. ABIN633308

Product Details anti-DDX59 Antibody

Target: DDX59 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 59 (DDX59))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX59 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DDX59 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX59 Blocking Peptide, catalog no. 33R-7302, is also available for use as a blocking control in assays to test for specificity of this DDX59 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX59 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX59

Target: DDX59 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 59 (DDX59))

Alternative Name: DDX59 (DDX59 Products)

Synonyms: si:dkey-39e8.2 antibody, ZNHIT5 antibody, 1210002B07Rik antibody, 4833411G06Rik antibody, DEAD-box helicase 59 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 59 antibody, DEAD-box helicase 59 L homeolog antibody, DDX59 antibody, ddx59 antibody, ddx59.L antibody, Ddx59 antibody

Background: The specific function of DDX59 is not yet known.

Molecular Weight: 69 kDa (MW of target protein)