DHX30 antibody
-
- Target See all DHX30 Antibodies
- DHX30 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 30 (DHX30))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DHX30 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD
- Top Product
- Discover our top product DHX30 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DHX30 Blocking Peptide, catalog no. 33R-1151, is also available for use as a blocking control in assays to test for specificity of this DHX30 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX30 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 30 (DHX30))
- Alternative Name
- DHX30 (DHX30 Products)
- Synonyms
- DHX30 antibody, dhx30 antibody, DDX30 antibody, RETCOR antibody, 2810477H02Rik antibody, C130058C04Rik antibody, Ddx30 antibody, HELG antibody, Ret-CoR antibody, DExH-box helicase 30 antibody, DEAH (Asp-Glu-Ala-His) box helicase 30 antibody, DEAH-box helicase 30 antibody, DEAH-box helicase 30 S homeolog antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 30 antibody, DHX30 antibody, dhx30 antibody, dhx30.S antibody, Dhx30 antibody
- Background
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX30 is a member of this family.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-