PSMA6 antibody

Catalog No. ABIN633332

Product Details anti-PSMA6 Antibody

Target: PSMA6 (Proteasome Subunit alpha 6 (PSMA6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMA6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PSMA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITEN

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSMA6 Blocking Peptide, catalog no. 33R-2815, is also available for use as a blocking control in assays to test for specificity of this PSMA6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSMA6

Target: PSMA6 (Proteasome Subunit alpha 6 (PSMA6))

Alternative Name: PSMA6 (PSMA6 Products)

Synonyms: IOTA antibody, PROS27 antibody, p27K antibody, psma6 antibody, psma6b antibody, zgc:91778 antibody, proteasome subunit alpha 6 antibody, proteasome (prosome, macropain) subunit, alpha type 6 antibody, proteasome subunit alpha 6a antibody, proteasome subunit alpha 6 L homeolog antibody, proteasome subunit alpha 6, like antibody, PSMA6 antibody, Psma6 antibody, psma6a antibody, psma6.L antibody, psma6l antibody

Background: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA6 is a member of the peptidase T1A family, which is a 20S core alpha subunit.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA