STRBP antibody (Middle Region)

Catalog No. ABIN633341

Product Details anti-STRBP Antibody

Target: STRBP (Spermatid Perinuclear RNA Binding Protein (STRBP))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STRBP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: STRBP antibody was raised against the middle region of STRBP

Purification: Affinity purified

Immunogen: STRBP antibody was raised using the middle region of STRBP corresponding to a region with amino acids PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STRBP Blocking Peptide, catalog no. 33R-7353, is also available for use as a blocking control in assays to test for specificity of this STRBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STRBP

Target: STRBP (Spermatid Perinuclear RNA Binding Protein (STRBP))

Alternative Name: STRBP (STRBP Products)

Synonyms: ILF3L antibody, SPNR antibody, p74 antibody, 6430510M02Rik antibody, AI852513 antibody, C230082I21Rik antibody, C86322 antibody, Spnr antibody, spermatid perinuclear RNA binding protein L homeolog antibody, spermatid perinuclear RNA binding protein antibody, strbp.L antibody, STRBP antibody, Strbp antibody

Background: STRBP contains 2 DRBM (double-stranded RNA-binding) domains and 1 DZF domain. STRBP is involved in spermatogenesis and sperm function. It plays a role in regulation of cell growth.

Molecular Weight: 74 kDa (MW of target protein)