RBM22 antibody (Middle Region)
-
- Target See all RBM22 Antibodies
- RBM22 (RNA Binding Motif Protein 22 (RBM22))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RBM22 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBM22 antibody was raised against the middle region of RBM22
- Purification
- Affinity purified
- Immunogen
- RBM22 antibody was raised using the middle region of RBM22 corresponding to a region with amino acids HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV
- Top Product
- Discover our top product RBM22 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBM22 Blocking Peptide, catalog no. 33R-3732, is also available for use as a blocking control in assays to test for specificity of this RBM22 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM22 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM22 (RNA Binding Motif Protein 22 (RBM22))
- Alternative Name
- RBM22 (RBM22 Products)
- Synonyms
- Cwc2 antibody, ZC3H16 antibody, fSAP47 antibody, 8430430L24Rik antibody, fb37a01 antibody, zgc:77910 antibody, wu:fb37a01 antibody, wu:fc62e03 antibody, wu:fe05c04 antibody, RBM22 antibody, cg14641 antibody, RNA binding motif protein 22 antibody, RNA binding motif protein 22 S homeolog antibody, RBM22 antibody, Rbm22 antibody, rbm22 antibody, rbm22.S antibody
- Background
- RBM22 may be involved in pre-mRNA splicing.
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-