DDX1 antibody
-
- Target See all DDX1 Antibodies
- DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1 (DDX1))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DDX1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGA
- Top Product
- Discover our top product DDX1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DDX1 Blocking Peptide, catalog no. 33R-4046, is also available for use as a blocking control in assays to test for specificity of this DDX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1 (DDX1))
- Alternative Name
- DDX1 (DDX1 Products)
- Synonyms
- CG9054 antibody, DDX1 antibody, Dbp79E antibody, DmDDX1 antibody, DmRH12 antibody, Dmel\\CG9054 antibody, anon-79E antibody, DBP-RB antibody, UKVH5d antibody, si:ch211-214k9.2 antibody, si:dkey-161f12.1 antibody, AA409185 antibody, Dead-box-1 antibody, DEAD-box helicase 1 antibody, DEAD/H-box helicase 1 L homeolog antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 1 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 antibody, Ddx1 antibody, DDX1 antibody, ddx1.L antibody, ddx1 antibody
- Background
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX1 is a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.
- Molecular Weight
- 82 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-