IFIH1 antibody (Middle Region)

Catalog No. ABIN633360

The Rabbit Polyclonal anti-IFIH1 antibody (ABIN633360) specifically detects IFIH1 in WB and IHC. The antibody is reactive with Human samples.

Quick Overview for IFIH1 antibody (Middle Region) (ABIN633360)

Target: IFIH1 (Interferon Induced with Helicase C Domain 1 (IFIH1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFIH1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-IFIH1 Antibody

Binding Specificity: Middle Region

Specificity: IFIH1 antibody was raised against the middle region of IFIH1

Purification: Affinity purified

Immunogen: IFIH1 antibody was raised using the middle region of IFIH1 corresponding to a region with amino acids QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFIH1 Blocking Peptide, (ABIN5614142), is also available for use as a blocking control in assays to test for specificity of this IFIH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFIH1

Target: IFIH1 (Interferon Induced with Helicase C Domain 1 (IFIH1))

Alternative Name: IFIH1

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. IFIH1 is a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents, treatment with either agent alone only achieves reversible differentiation.

Molecular Weight: 117 kDa (MW of target protein)

Pathways: Activation of Innate immune Response