DDX46 antibody
-
- Target See all DDX46 Antibodies
- DDX46 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 46 (DDX46))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DDX46 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DDX46 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKV
- Top Product
- Discover our top product DDX46 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DDX46 Blocking Peptide, catalog no. 33R-4763, is also available for use as a blocking control in assays to test for specificity of this DDX46 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX46 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX46 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 46 (DDX46))
- Alternative Name
- DDX46 (DDX46 Products)
- Synonyms
- MMI9.2 antibody, MMI9_2 antibody, RNA HELICASE antibody, fb39a03 antibody, fj67d06 antibody, wu:fb39a03 antibody, wu:fj67d06 antibody, PRPF5 antibody, Prp5 antibody, 2200005K02Rik antibody, 8430438J23Rik antibody, AI325430 antibody, AI957095 antibody, mKIAA0801 antibody, DEAD box RNA helicase (PRH75) antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 antibody, DEAD-box helicase 46 antibody, RNA helicase-like protein antibody, PRH75 antibody, ddx46 antibody, DDX46 antibody, Ddx46 antibody, TDRD12 antibody
- Background
- DDX46 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX46 is a component of the 17S U2 snRNP complex, it plays an important role in pre-mRNA splicing.
- Molecular Weight
- 117 kDa (MW of target protein)
-