RBMS3 antibody (Middle Region)
-
- Target See all RBMS3 Antibodies
- RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RBMS3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBMS3 antibody was raised against the middle region of RBMS3
- Purification
- Affinity purified
- Immunogen
- RBMS3 antibody was raised using the middle region of RBMS3 corresponding to a region with amino acids PTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK
- Top Product
- Discover our top product RBMS3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBMS3 Blocking Peptide, catalog no. 33R-7382, is also available for use as a blocking control in assays to test for specificity of this RBMS3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))
- Alternative Name
- RBMS3 (RBMS3 Products)
- Synonyms
- RBMS3 antibody, zgc:153698 antibody, 6720477E09Rik antibody, 8430436O14Rik antibody, RNA binding motif single stranded interacting protein 3 antibody, RNA binding motif, single stranded interacting protein antibody, RNA binding motif, single stranded interacting protein 3 antibody, RBMS3 antibody, rbms3 antibody, Rbms3 antibody
- Background
- RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2.
- Molecular Weight
- 46 kDa (MW of target protein)
-