RG9MTD1 antibody
-
- Target See all RG9MTD1 Antibodies
- RG9MTD1 (RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RG9MTD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RG9 MTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMG
- Top Product
- Discover our top product RG9MTD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RG9MTD1 Blocking Peptide, catalog no. 33R-4449, is also available for use as a blocking control in assays to test for specificity of this RG9MTD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RG9MTD1 (RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1))
- Alternative Name
- RG9MTD1 (RG9MTD1 Products)
- Synonyms
- RG9MTD1 antibody, rg9mtd1 antibody, wu:fb53e06 antibody, zgc:103570 antibody, HNYA antibody, MRPP1 antibody, Rg9mtd1 antibody, 1300018J16Rik antibody, D16Ertd454e antibody, Rnmtd1 antibody, tRNA methyltransferase 10C, mitochondrial RNase P subunit antibody, tRNA methyltransferase 10C, mitochondrial RNase P subunit L homeolog antibody, tRNA methyltransferase 10C antibody, TRMT10C antibody, trmt10c antibody, trmt10c.L antibody, Trmt10c antibody
- Background
- RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.
- Molecular Weight
- 47 kDa (MW of target protein)
-