RBMY1A1 antibody (N-Term)
-
- Target See all RBMY1A1 Antibodies
- RBMY1A1 (RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RBMY1A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBMY1 A1 antibody was raised against the N terminal of RBMY1 1
- Purification
- Affinity purified
- Immunogen
- RBMY1 A1 antibody was raised using the N terminal of RBMY1 1 corresponding to a region with amino acids MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN
- Top Product
- Discover our top product RBMY1A1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBMY1A1 Blocking Peptide, catalog no. 33R-6530, is also available for use as a blocking control in assays to test for specificity of this RBMY1A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMY0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBMY1A1 (RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1))
- Alternative Name
- RBMY1A1 (RBMY1A1 Products)
- Synonyms
- RBM antibody, Rbm1 antibody, Rbm1-rs1 antibody, Rbmy1a1 antibody, Rbmy1a1-rs1 antibody, Rbmy1b antibody, RBM1 antibody, RBM2 antibody, RBMY antibody, RBMY1C antibody, YRRM1 antibody, YRRM2 antibody, RNA binding motif protein, Y chromosome antibody, RNA binding motif protein, Y-linked, family 1, member A1 antibody, Rbmy antibody, RBMY1A1 antibody
- Background
- RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.
- Molecular Weight
- 41 kDa (MW of target protein)
-