RPS24 antibody (Middle Region)
-
- Target See all RPS24 Antibodies
- RPS24 (Ribosomal Protein S24 (RPS24))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPS24 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPS24 antibody was raised against the middle region of RPS24
- Purification
- Affinity purified
- Immunogen
- RPS24 antibody was raised using the middle region of RPS24 corresponding to a region with amino acids GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT
- Top Product
- Discover our top product RPS24 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPS24 Blocking Peptide, catalog no. 33R-3257, is also available for use as a blocking control in assays to test for specificity of this RPS24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPS24 (Ribosomal Protein S24 (RPS24))
- Alternative Name
- RPS24 (RPS24 Products)
- Synonyms
- DBA3 antibody, S24 antibody, ribosomal protein S24 L homeolog antibody, ribosomal protein S24 antibody, rps24.L antibody, RPS24 antibody, Rps24 antibody
- Background
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
- Molecular Weight
- 15 kDa (MW of target protein)
-