SNRPA1 antibody (Middle Region)

Catalog No. ABIN633565

Product Details anti-SNRPA1 Antibody

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRPA1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SNRPA antibody was raised against the middle region of SNRPA

Purification: Affinity purified

Immunogen: SNRPA antibody was raised using the middle region of SNRPA corresponding to a region with amino acids MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRPA Blocking Peptide, catalog no. 33R-6281, is also available for use as a blocking control in assays to test for specificity of this SNRPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRPA1

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Alternative Name: SNRPA (SNRPA Products)

Synonyms: Mud1 antibody, U1-A antibody, U1A antibody, im:7142962 antibody, zgc:101832 antibody, C430021M15Rik antibody, Rnu1a-1 antibody, Rnu1a1 antibody, mud1 antibody, snf antibody, fc19d01 antibody, wu:fc19d01 antibody, zgc:77810 antibody, T30B22.12 antibody, U1SNRNP-SPECIFIC PROTEIN antibody, spliceosomal protein U1A antibody, small nuclear ribonucleoprotein polypeptide A antibody, small nuclear ribonucleoprotein polypeptide A' antibody, small nuclear ribonucleoprotein polypeptide A S homeolog antibody, spliceosomal protein U1A antibody, SNRPA antibody, snrpa1 antibody, Snrpa antibody, snrpa.S antibody, snrpa antibody, U1A antibody

Background: SNRPA binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process.

Molecular Weight: 31 kDa (MW of target protein)