Add to Basket
Order hotline:
 |
+1 404 474 4654 |
 |
+1 888 205 9894 (TF) |
A Kinase (PRKA) Anchor Protein 1 (AKAP1) antibody
| Antigen | A Kinase (PRKA) Anchor Protein 1 (AKAP1) |
| Synonyms | AKAP, PRKA1, AKAP84, AKAP121, AKAP149, D-AKAP1, MGC1807, SAKAP84, Akap, C76494, C81186, DAKAP1, S-AKAP84, AKAP1, akap1, fa08b04, MGC162884, wu:fa08b04, Akap84 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Application |
Alternatives Western Blotting (WB)
|
| Catalog no. | ABIN633600 |
| Quantity | 50 ug (1 mg/ml) (Variants) |
| Price | 478.33 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 5 to 7 Business Days |
Additional Information
| Alternative name | AKAP1 |
| Immunogen | AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF |
| Description | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. |
| Molecular Weight | 65 kDa (MW of target protein) |
Application Details
| Concentration | 1 mg/ml |
| Purification | Affinity purified |
| Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AKAP1 antibody in PBS |
| Storage | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
| Research Area | Signaling |
Alternatives
Alternatives for antigen "A Kinase (PRKA) Anchor Protein 1 (AKAP1)", type "Antibodies"
| Hosts | Rabbit (4), Mouse (3) |
| Reactivities | Human (7) |
| Applications | Western Blotting (WB) (7), Immunofluorescence (IF) (3), ELISA (2), ELISA (Detection) (2), Immunohistochemistry (IHC) (2), Enzyme Immunoassay (EIA) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1) |
