SMNDC1 antibody (Middle Region)
-
- Target See all SMNDC1 Antibodies
- SMNDC1 (Survival Motor Neuron Domain Containing 1 (SMNDC1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SMNDC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SMNDC1 antibody was raised against the middle region of SMNDC1
- Purification
- Affinity purified
- Immunogen
- SMNDC1 antibody was raised using the middle region of SMNDC1 corresponding to a region with amino acids QFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSK
- Top Product
- Discover our top product SMNDC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SMNDC1 Blocking Peptide, catalog no. 33R-7549, is also available for use as a blocking control in assays to test for specificity of this SMNDC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMNDC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMNDC1 (Survival Motor Neuron Domain Containing 1 (SMNDC1))
- Alternative Name
- SMNDC1 (SMNDC1 Products)
- Synonyms
- smnr antibody, spf30 antibody, SMNDC1 antibody, SMNR antibody, SPF30 antibody, TDRD16C antibody, wu:fb37h07 antibody, wu:fc23a07 antibody, 2410004J23Rik antibody, 4933440I19Rik antibody, survival motor neuron domain containing 1 antibody, smndc1 antibody, SMNDC1 antibody, Bm1_41545 antibody, Smndc1 antibody
- Background
- This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. SMNDC1 is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy.
- Molecular Weight
- 27 kDa (MW of target protein)
-