KCNIP2 antibody (N-Term)
-
- Target See all KCNIP2 Antibodies
- KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNIP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNIP2 antibody was raised against the N terminal of KCNIP2
- Purification
- Affinity purified
- Immunogen
- KCNIP2 antibody was raised using the N terminal of KCNIP2 corresponding to a region with amino acids PEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQG
- Top Product
- Discover our top product KCNIP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNIP2 Blocking Peptide, catalog no. 33R-7044, is also available for use as a blocking control in assays to test for specificity of this KCNIP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNIP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))
- Alternative Name
- KCNIP2 (KCNIP2 Products)
- Synonyms
- KCHIP2 antibody, KCNIP2 antibody, Kchip2 antibody, KChIP2 antibody, kchip2 antibody, si:ch73-173h19.2 antibody, potassium voltage-gated channel interacting protein 2 antibody, Kv channel-interacting protein 2 antibody, Kv channel interacting protein 2 S homeolog antibody, Kv channel interacting protein 2 antibody, KCNIP2 antibody, Kcnip2 antibody, kcnip2.S antibody, kcnip2 antibody
- Background
- The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium.
- Molecular Weight
- 21 kDa (MW of target protein)
-