KCNH7 antibody
-
- Target See all KCNH7 Antibodies
- KCNH7 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 7 (KCNH7))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNH7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- KCNH7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV
- Top Product
- Discover our top product KCNH7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNH7 Blocking Peptide, catalog no. 33R-7158, is also available for use as a blocking control in assays to test for specificity of this KCNH7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNH7 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 7 (KCNH7))
- Alternative Name
- KCNH7 (KCNH7 Products)
- Synonyms
- KCNH7 antibody, kcnh7 antibody, ERG3 antibody, HERG3 antibody, Kv11.3 antibody, 9330137I11Rik antibody, erg3 antibody, potassium voltage-gated channel subfamily H member 7 antibody, potassium channel, voltage gated eag related subfamily H, member 7 antibody, potassium voltage-gated channel, subfamily H (eag-related), member 7 antibody, KCNH7 antibody, kcnh7 antibody, LOC100545485 antibody, Kcnh7 antibody
- Background
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH7 is a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.
- Molecular Weight
- 83 kDa (MW of target protein)
-