KCNA7 antibody (C-Term)

Catalog No. ABIN633690

Product Details anti-KCNA7 Antibody

Target: KCNA7 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 7 (KCNA7))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNA7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNA7 antibody was raised against the C terminal of KCNA7

Purification: Affinity purified

Immunogen: KCNA7 antibody was raised using the C terminal of KCNA7 corresponding to a region with amino acids GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNA7 Blocking Peptide, catalog no. 33R-3222, is also available for use as a blocking control in assays to test for specificity of this KCNA7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNA7

Target: KCNA7 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 7 (KCNA7))

Alternative Name: KCNA7 (KCNA7 Products)

Synonyms: hak6 antibody, kv1.7 antibody, XKv1.10 antibody, kvl10-A antibody, HAK6 antibody, KV1.7 antibody, Kv1.7 antibody, potassium channel, voltage gated shaker related subfamily A, member 7 S homeolog antibody, potassium voltage-gated channel subfamily A member 7 antibody, potassium voltage-gated channel, shaker-related subfamily, member 7 antibody, kcna7.S antibody, KCNA7 antibody, Kcna7 antibody

Background: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.

Molecular Weight: 50 kDa (MW of target protein)