KCNV1 antibody (N-Term)
-
- Target See all KCNV1 Antibodies
- KCNV1 (Potassium Channel, Subfamily V, Member 1 (KCNV1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNV1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNV1 antibody was raised against the N terminal of KCNV1
- Purification
- Affinity purified
- Immunogen
- KCNV1 antibody was raised using the N terminal of KCNV1 corresponding to a region with amino acids ALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVP
- Top Product
- Discover our top product KCNV1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNV1 Blocking Peptide, catalog no. 33R-1332, is also available for use as a blocking control in assays to test for specificity of this KCNV1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNV1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNV1 (Potassium Channel, Subfamily V, Member 1 (KCNV1))
- Alternative Name
- KCNV1 (KCNV1 Products)
- Synonyms
- HNKA antibody, KCNB3 antibody, KV2.3 antibody, KV8.1 antibody, 2700023A03Rik antibody, vibe antibody, Kv8.1 antibody, potassium voltage-gated channel modifier subfamily V member 1 antibody, potassium channel, subfamily V, member 1 antibody, KCNV1 antibody, Kcnv1 antibody
- Background
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNV1 is a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types.
- Molecular Weight
- 56 kDa (MW of target protein)
-