KCNK12 antibody (Middle Region)
-
- Target See all KCNK12 Antibodies
- KCNK12 (Potassium Channel, Subfamily K, Member 12 (KCNK12))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNK12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNK12 antibody was raised against the middle region of KCNK12
- Purification
- Affinity purified
- Immunogen
- KCNK12 antibody was raised using the middle region of KCNK12 corresponding to a region with amino acids EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF
- Top Product
- Discover our top product KCNK12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNK12 Blocking Peptide, catalog no. 33R-2445, is also available for use as a blocking control in assays to test for specificity of this KCNK12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNK12 (Potassium Channel, Subfamily K, Member 12 (KCNK12))
- Alternative Name
- KCNK12 (KCNK12 Products)
- Synonyms
- KCNK12 antibody, K2p12.1 antibody, THIK-2 antibody, THIK2 antibody, mntk1 antibody, potassium two pore domain channel subfamily K member 12 antibody, potassium channel, subfamily K, member 12 antibody, KCNK12 antibody, Kcnk12 antibody
- Background
- KCNK12 is a member of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK12 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.
- Molecular Weight
- 47 kDa (MW of target protein)
-