KCNJ8 antibody (Middle Region)

Catalog No. ABIN633704

Product Details anti-KCNJ8 Antibody

Target: KCNJ8 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 8 (KCNJ8))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNJ8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNJ8 antibody was raised against the middle region of KCNJ8

Purification: Affinity purified

Immunogen: KCNJ8 antibody was raised using the middle region of KCNJ8 corresponding to a region with amino acids EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNJ8 Blocking Peptide, catalog no. 33R-2518, is also available for use as a blocking control in assays to test for specificity of this KCNJ8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNJ8

Target: KCNJ8 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 8 (KCNJ8))

Alternative Name: KCNJ8 (KCNJ8 Products)

Synonyms: kir6.1 antibody, KIR6.1 antibody, uKATP-1 antibody, AI448900 antibody, Kir6.1 antibody, gnite antibody, slmbr antibody, sltr antibody, UKATP1 antibody, si:dkey-183c2.2 antibody, zkir6.1 antibody, potassium voltage-gated channel subfamily J member 8 antibody, potassium channel, inwardly rectifying subfamily J, member 8 antibody, potassium inwardly-rectifying channel, subfamily J, member 8 antibody, potassium channel, inwardly rectifying subfamily J, member 8 S homeolog antibody, KCNJ8 antibody, kcnj8 antibody, Kcnj8 antibody, kcnj8.S antibody

Background: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. KCNJ8 is an integral membrane protein and inward-rectifier type potassium channel. KCNJ8, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins.Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses.

Molecular Weight: 48 kDa (MW of target protein)