KCNJ8 antibody (Middle Region)
-
- Target See all KCNJ8 Antibodies
- KCNJ8 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 8 (KCNJ8))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNJ8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNJ8 antibody was raised against the middle region of KCNJ8
- Purification
- Affinity purified
- Immunogen
- KCNJ8 antibody was raised using the middle region of KCNJ8 corresponding to a region with amino acids EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK
- Top Product
- Discover our top product KCNJ8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNJ8 Blocking Peptide, catalog no. 33R-2518, is also available for use as a blocking control in assays to test for specificity of this KCNJ8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNJ8 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 8 (KCNJ8))
- Alternative Name
- KCNJ8 (KCNJ8 Products)
- Synonyms
- kir6.1 antibody, KIR6.1 antibody, uKATP-1 antibody, AI448900 antibody, Kir6.1 antibody, gnite antibody, slmbr antibody, sltr antibody, UKATP1 antibody, si:dkey-183c2.2 antibody, zkir6.1 antibody, potassium voltage-gated channel subfamily J member 8 antibody, potassium channel, inwardly rectifying subfamily J, member 8 antibody, potassium inwardly-rectifying channel, subfamily J, member 8 antibody, potassium channel, inwardly rectifying subfamily J, member 8 S homeolog antibody, KCNJ8 antibody, kcnj8 antibody, Kcnj8 antibody, kcnj8.S antibody
- Background
- Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. KCNJ8 is an integral membrane protein and inward-rectifier type potassium channel. KCNJ8, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins.Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses.
- Molecular Weight
- 48 kDa (MW of target protein)
-