P2RX2 antibody (N-Term)

Catalog No. ABIN633718

This Rabbit Polyclonal antibody specifically detects P2RX2 in WB. It exhibits reactivity toward Human.

Quick Overview for P2RX2 antibody (N-Term) (ABIN633718)

Target: P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This P2RX2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-P2RX2 Antibody

Binding Specificity: N-Term

Specificity: P2 RX2 antibody was raised against the N terminal of P2 X2

Purification: Affinity purified

Immunogen: P2 RX2 antibody was raised using the N terminal of P2 X2 corresponding to a region with amino acids VRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

P2RX2 Blocking Peptide, (ABIN5615164), is also available for use as a blocking control in assays to test for specificity of this P2RX2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for P2RX2

Target: P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))

Alternative Name: P2RX2

Background: The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity