FXYD7 antibody (N-Term)
-
- Target See all FXYD7 Antibodies
- FXYD7 (FXYD Domain Containing Ion Transport Regulator 7 (FXYD7))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FXYD7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FXYD7 antibody was raised against the N terminal of FXYD7
- Purification
- Affinity purified
- Immunogen
- FXYD7 antibody was raised using the N terminal of FXYD7 corresponding to a region with amino acids MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK
- Top Product
- Discover our top product FXYD7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FXYD7 Blocking Peptide, catalog no. 33R-5788, is also available for use as a blocking control in assays to test for specificity of this FXYD7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXYD7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FXYD7 (FXYD Domain Containing Ion Transport Regulator 7 (FXYD7))
- Alternative Name
- FXYD7 (FXYD7 Products)
- Synonyms
- 1110035I01Rik antibody, FXYD domain containing ion transport regulator 7 antibody, FXYD domain-containing ion transport regulator 7 antibody, FXYD7 antibody, Fxyd7 antibody
- Background
- This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator.
- Molecular Weight
- 8 kDa (MW of target protein)
-