GABRB3 antibody

Catalog No. ABIN633769

This Rabbit Polyclonal antibody specifically detects GABRB3 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for GABRB3 antibody (ABIN633769)

Target: GABRB3 (gamma-aminobutyric Acid (GABA) A Receptor, beta 3 (GABRB3))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABRB3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GABRB3 Antibody

Purification: Affinity purified

Immunogen: GABRB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABRB3 Blocking Peptide, (ABIN938138), is also available for use as a blocking control in assays to test for specificity of this GABRB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABRB3

Target: GABRB3 (gamma-aminobutyric Acid (GABA) A Receptor, beta 3 (GABRB3))

Alternative Name: GABRB3

Background: GABRB3 is a member of the ligand-gated ionic channel family. GABRB3 is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. Mutations in this gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Sensory Perception of Sound