GABRA4 antibody

Catalog No. ABIN633778

Product Details anti-GABRA4 Antibody

Target: GABRA4 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 4 (GABRA4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABRA4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GABRA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABRA4 Blocking Peptide, catalog no. 33R-6607, is also available for use as a blocking control in assays to test for specificity of this GABRA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABRA4

Target: GABRA4 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 4 (GABRA4))

Alternative Name: GABRA4 (GABRA4 Products)

Synonyms: GABRA4 antibody, Gabra-4 antibody, gamma-aminobutyric acid type A receptor alpha4 subunit antibody, gamma-aminobutyric acid (GABA) A receptor, subunit alpha 4 antibody, GABRA4 antibody, Gabra4 antibody

Background: GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Synaptic Membrane