GABRE antibody

Catalog No. ABIN633794

The Rabbit Polyclonal anti-GABRE antibody is suitable to detect GABRE in samples from Human. It has been validated for WB.

Quick Overview for GABRE antibody (ABIN633794)

Target: GABRE (gamma-aminobutyric Acid (GABA) A Receptor, epsilon (GABRE))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABRE antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GABRE Antibody

Purification: Affinity purified

Immunogen: GABRE antibody was raised using a synthetic peptide corresponding to a region with amino acids DVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABRE Blocking Peptide, (ABIN937615), is also available for use as a blocking control in assays to test for specificity of this GABRE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABRE

Target: GABRE (gamma-aminobutyric Acid (GABA) A Receptor, epsilon (GABRE))

Alternative Name: GABRE

Background: GABRE belongs to the ligand-gated ionic channel family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Synaptic Membrane