SCN3B antibody (N-Term)
-
- Target See all SCN3B Antibodies
- SCN3B (Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B))
-
Binding Specificity
- N-Term
-
Reactivity
- Rat, Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SCN3B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SCN3 B antibody was raised against the N terminal of SCN3
- Purification
- Affinity purified
- Immunogen
- SCN3 B antibody was raised using the N terminal of SCN3 corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
- Top Product
- Discover our top product SCN3B Primary Antibody
-
-
- Application Notes
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SCN3B Blocking Peptide, catalog no. 33R-8090, is also available for use as a blocking control in assays to test for specificity of this SCN3B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCN3B (Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B))
- Alternative Name
- SCN3B (SCN3B Products)
- Synonyms
- 1110001K16Rik antibody, 4833414B02Rik antibody, Scnb3 antibody, HSA243396 antibody, SCNB3 antibody, sodium voltage-gated channel beta subunit 3 antibody, sodium channel, voltage-gated, type III, beta antibody, SCN3B antibody, Scn3b antibody
- Background
- SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.
- Molecular Weight
- 24 kDa (MW of target protein)
-