DPYSL3 antibody (Middle Region)
-
- Target See all DPYSL3 Antibodies
- DPYSL3 (Dihydropyrimidinase-Like 3 (DPYSL3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DPYSL3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DPYSL3 antibody was raised against the middle region of DPYSL3
- Purification
- Affinity purified
- Immunogen
- DPYSL3 antibody was raised using the middle region of DPYSL3 corresponding to a region with amino acids VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSA
- Top Product
- Discover our top product DPYSL3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DPYSL3 Blocking Peptide, catalog no. 33R-9522, is also available for use as a blocking control in assays to test for specificity of this DPYSL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYSL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPYSL3 (Dihydropyrimidinase-Like 3 (DPYSL3))
- Alternative Name
- DPYSL3 (DPYSL3 Products)
- Synonyms
- CRMP4A antibody, CRMP4B antibody, dpysl3 antibody, DRP-3 antibody, MGC69487 antibody, dpysl3-b antibody, crmp4 antibody, CRMP-4 antibody, xCRMP4 antibody, DRP-3-B antibody, DPYSL3 antibody, CRMP4 antibody, DRP3 antibody, LCRMP antibody, ULIP antibody, ULIP-1 antibody, TUC4 antibody, Ulip antibody, Ulip1 antibody, Crmp4 antibody, TUC-4b antibody, drp-3 antibody, drp3 antibody, lcrmp antibody, nsp1 antibody, tuc-4 antibody, tuc4 antibody, ulip antibody, ulip-1 antibody, dihydropyrimidinase like 3 antibody, dihydropyrimidinase like 3 L homeolog antibody, dihydropyrimidinase-like 3 antibody, dihydropyrimidinase like 3 S homeolog antibody, DPYSL3 antibody, dpysl3 antibody, dpysl3.L antibody, Dpysl3 antibody, dpysl3.S antibody
- Background
- DPYSL3 is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. DPYSL3 plays a role in axon guidance, neuronal growth cone collapse and cell migration.
- Molecular Weight
- 62 kDa (MW of target protein)
-