PHYH antibody (Middle Region)
-
- Target See all PHYH Antibodies
- PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PHYH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PHYH antibody was raised against the middle region of PHYH
- Purification
- Affinity purified
- Immunogen
- PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI
- Top Product
- Discover our top product PHYH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PHYH Blocking Peptide, catalog no. 33R-2503, is also available for use as a blocking control in assays to test for specificity of this PHYH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))
- Alternative Name
- PHYH (PHYH Products)
- Synonyms
- zgc:110203 antibody, LN1 antibody, LNAP1 antibody, PAHX antibody, PHYH1 antibody, RD antibody, AI256161 antibody, AI265699 antibody, Lnap1 antibody, phytanoyl-CoA 2-hydroxylase antibody, phytanoyl-CoA hydroxylase-like antibody, phytanoyl-CoA hydroxylase antibody, PHYH antibody, LOC478001 antibody, phyh antibody, Phyh antibody
- Background
- This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-