PHYH antibody (Middle Region)

Catalog No. ABIN633832

Product Details anti-PHYH Antibody

Target: PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PHYH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PHYH antibody was raised against the middle region of PHYH

Purification: Affinity purified

Immunogen: PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PHYH Blocking Peptide, catalog no. 33R-2503, is also available for use as a blocking control in assays to test for specificity of this PHYH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PHYH

Target: PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))

Alternative Name: PHYH (PHYH Products)

Synonyms: zgc:110203 antibody, LN1 antibody, LNAP1 antibody, PAHX antibody, PHYH1 antibody, RD antibody, AI256161 antibody, AI265699 antibody, Lnap1 antibody, phytanoyl-CoA 2-hydroxylase antibody, phytanoyl-CoA hydroxylase-like antibody, phytanoyl-CoA hydroxylase antibody, PHYH antibody, LOC478001 antibody, phyh antibody, Phyh antibody

Background: This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process