Chromogranin A antibody
-
- Target See all Chromogranin A (CHGA) Antibodies
- Chromogranin A (CHGA)
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Chromogranin A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Chromogranin A antibody was raised using a synthetic peptide corresponding to a region with amino acids DSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ
- Top Product
- Discover our top product CHGA Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Chromogranin A Blocking Peptide, catalog no. 33R-2167, is also available for use as a blocking control in assays to test for specificity of this Chromogranin A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHGA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Chromogranin A (CHGA)
- Alternative Name
- Chromogranin A (CHGA Products)
- Synonyms
- CGA antibody, CG-ALPHA antibody, FSHA antibody, GPHA1 antibody, GPHa antibody, HCG antibody, LHA antibody, TSHA antibody, ChrA antibody, fj05f09 antibody, si:dkey-177p2.2 antibody, wu:fj05f09 antibody, zgc:101749 antibody, zgc:56075 antibody, CHGA antibody, cgA antibody, chga antibody, chromogranin A antibody, glycoprotein hormones, alpha polypeptide antibody, uncharacterized CHGA antibody, chromogranin A S homeolog antibody, CHGA antibody, CGA antibody, Chga antibody, chga antibody, chga.S antibody
- Background
- CHGA is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. Its gene product is a precursor to three biologically active peptides, vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling
-