ART5 antibody (Middle Region)
-
- Target See all ART5 Antibodies
- ART5 (ADP-Ribosyltransferase 5 (ART5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ART5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ART5 antibody was raised against the middle region of ART5
- Purification
- Affinity purified
- Immunogen
- ART5 antibody was raised using the middle region of ART5 corresponding to a region with amino acids VFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGE
- Top Product
- Discover our top product ART5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ART5 Blocking Peptide, catalog no. 33R-9536, is also available for use as a blocking control in assays to test for specificity of this ART5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ART5 (ADP-Ribosyltransferase 5 (ART5))
- Alternative Name
- ART5 (ART5 Products)
- Synonyms
- ARTC5 antibody, Yac-2 antibody, ART5 antibody, Art5 antibody, art5 antibody, ADP-ribosyltransferase 5 antibody, ecto-ADP-ribosyltransferase 5-like antibody, ecto-ADP-ribosyltransferase 5 antibody, ADP-ribosyltransferase 5 L homeolog antibody, ART5 antibody, Art5 antibody, LOC618664 antibody, LOC100715378 antibody, art5.L antibody
- Background
- The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Transcript variants with different 5' UTRs, but encoding the same protein have been found for this gene.
- Molecular Weight
- 30 kDa (MW of target protein)
-